Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PEDFR/PNPLA2/ATGL Antibody, Novus Biologicals™
SDP

Numéro de catalogue. NB403308 missing translation for 'brandsLinkText'
Modifier l'affichage
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Numéro de catalogue. Quantity
NB403308 25 μL
NBP258046 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Numéro de catalogue. NB403308 Fournisseur Novus Biologicals Code fournisseur NBP25804625UL
Ajouter au panier
Ajouter au panier

Rabbit Polyclonal Antibody

PEDFR/PNPLA2/ATGL Polyclonal specifically detects PEDFR/PNPLA2/ATGL in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Spécifications

Antigen PEDFR/PNPLA2/ATGL
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 μg/mL
Formulation PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
Gene Alias Adipose triglyceride lipase, ATGL1110001C14Rik, Calcium-independent phospholipase A2, Desnutrin, EC 3.1.1.3, FP17548, IPLA2-zeta, patatin-like phospholipase domain containing 2, patatin-like phospholipase domain-containing protein 2, patatin-like phospholipase domain-containing protein 2-like, PEDF-R, Pigment epithelium-derived factor, Transport-secretion protein 2, transport-secretion protein 2.2, triglyceride hydrolase, TTS2.2, TTS-2.2, TTS2DKFZp667M109
Gene Symbols PNPLA2
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SICQYLVMRAKRKLGRHLPSRLPEQVELRRVQSLPSVPLSCAAYREALPGWMRNNLSLGDALAKWEECQRQLLLGLFCTNVAFPPEALRMRA
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Autophagy, Cancer, Diabetes Research, Lipid and Metabolism, Lipid Droplets, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 57104
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Afficher plus de résultats Afficher moins de résultats

For Research Use Only

missing translation for 'productTitle'
missing translation for 'pleaseSelectIssue'

missing translation for 'byClickingSubmit' missing translation for 'privacyPolicy'.