PEDFR/PNPLA2/ATGL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25748025UL

Catalog No. NB393939

Description

PEDFR/PNPLA2/ATGL Polyclonal specifically detects PEDFR/PNPLA2/ATGL in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: PEDFR/PNPLA2/ATGL
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: Adipose triglyceride lipase, ATGL1110001C14Rik, Calcium-independent phospholipase A2, Desnutrin, EC 3.1.1.3, FP17548, IPLA2-zeta, patatin-like phospholipase domain containing 2, patatin-like phospholipase domain-containing protein 2, patatin-like phospholipase domain-containing protein 2-like, PEDF-R, Pigment epithelium-derived factor, Transport-secretion protein 2, transport-secretion protein 2.2, triglyceride hydrolase, TTS2.2, TTS-2.2, TTS2DKFZp667M109
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PNPLA2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FSGESDICPQDSSTNIHELRVTNTSIQFNLRNLYRLSKALFPPEPLVLREMCKQGYRDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQA
• Quantity: 25 μL
• Research Discipline: Autophagy, Cancer, Diabetes Research, Lipid and Metabolism, Lipid Droplets, Signal Transduction
• Gene ID (Entrez): 57104
• Target Species: Human
• Form: Purified

For Research Use Only