Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Pentraxin 3/TSG-14 Antibody, Novus Biologicals™

Pentraxin 3/TSG-14 Antibody, Novus Biologicals™
SDP

Catalog No. NB395607 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB395607 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB395607 Supplier Novus Biologicals Supplier No. NBP24959525UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Pentraxin 3/TSG-14 Polyclonal antibody specifically detects Pentraxin 3/TSG-14 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen Pentraxin 3/TSG-14
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2), 40% Glycerol
Gene Alias alpha-induced protein 5, pentaxin-related gene, rapidly induced by IL-1 beta, tumor necrosis factor, Pentaxin-related protein PTX3, pentraxin 3, long, pentraxin-3, pentraxin-related gene, rapidly induced by IL-1 beta, pentraxin-related protein PTX3, TNF alpha-induced protein 5, TNFAIP5, TSG14, TSG-14pentaxin-related gene, rapidly induced by IL-1 beta, Tumor necrosis factor alpha-induced protein 5, tumor necrosis factor, alpha-induced protein 5, Tumor necrosis factor-inducible gene 14 protein, tumor necrosis factor-inducible protein TSG-14
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: GFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYVS
Purification Method Immunogen affinity purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Immunology
Primary or Secondary Primary
Gene ID (Entrez) 5806
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.