Peroxiredoxin 3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP153060

Catalog No. NBP153060

Description

Peroxiredoxin 3 Polyclonal specifically detects Peroxiredoxin 3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Peroxiredoxin 3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: PRDX3
• Immunogen: Synthetic peptides corresponding to PRDX3(peroxiredoxin 3) The peptide sequence was selected from the N terminal of PRDX3. Peptide sequence AIPWGISATAALRPAACGRTSLTNLLCSGSSQAPYFKGTAVVNGEFKDLS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin
• Gene Alias: Antioxidant protein 1MGC104387, AOP-1MGC24293, AOP1PRO1748, EC 1.11.1.15, HBC189, MER5, peroxiredoxin 3, Peroxiredoxin III, peroxiredoxin-3, Protein MER5 homolog, prx-III, SP-22, thioredoxin-dependent peroxide reductase, mitochondrial
• Host Species: Rabbit
• Molecular Weight of Antigen: 26 kDa
• Quantity: 100 μL
• Research Discipline: Core ESC Like Genes, Stem Cell Markers
• Gene ID (Entrez): 10935
• Target Species: Human
• Isotype: IgG