Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Peroxiredoxin 3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | Peroxiredoxin 3 |
|---|---|
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Regulatory Status | RUO |
Description
Peroxiredoxin 3 Polyclonal specifically detects Peroxiredoxin 3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Peroxiredoxin 3 | |
| Unconjugated | |
| RUO | |
| Human | |
| 10935 | |
| Synthetic peptides corresponding to PRDX3(peroxiredoxin 3) The peptide sequence was selected from the N terminal of PRDX3. Peptide sequence AIPWGISATAALRPAACGRTSLTNLLCSGSSQAPYFKGTAVVNGEFKDLS. | |
| Primary |
| Polyclonal | |
| Rabbit | |
| Core ESC Like Genes, Stem Cell Markers | |
| Antioxidant protein 1MGC104387, AOP-1MGC24293, AOP1PRO1748, EC 1.11.1.15, HBC189, MER5, peroxiredoxin 3, Peroxiredoxin III, peroxiredoxin-3, Protein MER5 homolog, prx-III, SP-22, thioredoxin-dependent peroxide reductase, mitochondrial | |
| PRDX3 | |
| IgG | |
| 26 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title