Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Peroxiredoxin 3 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Manufacturer:  Novus Biologicals NBP153060

 View more versions of this product

Catalog No. NBP153060


Add to cart

Description

Description

Peroxiredoxin 3 Polyclonal antibody specifically detects Antigen in Human samples. It is validated for Immunocytochemistry/Immunofluorescence, Western Blotting.
Specifications

Specifications

Peroxiredoxin 3
Unconjugated
PBS and 2% Sucrose with 0.09% Sodium Azide
Antioxidant protein 1MGC104387, AOP-1MGC24293, AOP1PRO1748, EC 1.11.1.15, HBC189, MER5, peroxiredoxin 3, Peroxiredoxin III, peroxiredoxin-3, Protein MER5 homolog, prx-III, SP-22, thioredoxin-dependent peroxide reductase, mitochondrial
Rabbit
IgG
Immunogen affinity purified
RUO
Store at -20C. Avoid freeze-thaw cycles.
Polyclonal
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Western Blot
Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence
Affinity Purified
PRDX3
Synthetic peptides corresponding to PRDX3(peroxiredoxin 3) The peptide sequence was selected from the N terminal of PRDX3. Peptide sequence AIPWGISATAALRPAACGRTSLTNLLCSGSSQAPYFKGTAVVNGEFKDLS.
26 kDa
100 ul
Core ESC Like Genes, Stem Cell Markers
Primary
10935
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit