Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP155160

Peroxiredoxin 6 Antibody, Novus Biologicals™
SDP

Catalog No. NBP155160 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP155160 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP155160 Supplier Novus Biologicals Supplier No. NBP155160

Description

Rabbit Polyclonal Antibody

Peroxiredoxin 6 Polyclonal specifically detects Peroxiredoxin 6 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Peroxiredoxin 6
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P30041
Gene Alias 1-Cys, 24 kDa protein, Acidic calcium-independent phospholipase A2, aiPLA21-Cys PRX, Antioxidant protein 2, AOP2Non-selenium glutathione peroxidase, EC 1.11.1.15, EC 1.11.1.7, EC 3.1.1.-, KIAA0106Red blood cells page spot 12, Liver 2D page spot 40, MGC46173, NSGPx1-Cys peroxiredoxin, p29, peroxiredoxin 6, peroxiredoxin-6, PRX
Gene Symbols PRDX6
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PRDX6(peroxiredoxin 6) The peptide sequence was selected from the C terminal of PRDX6. Peptide sequence VATPVDWKDGDSVMVLPTIPEEEAKKLFPKGVFTKELPSGKKYLRYTPQP.
Molecular Weight of Antigen 25 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9588
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.