Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP16243420

PERP Antibody, Novus Biologicals™
SDP

Catalog No. NBP16243420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16243420 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP16243420 Supplier Novus Biologicals Supplier No. NBP16243420UL

Description

Rabbit Polyclonal Antibody

PERP Polyclonal specifically detects PERP in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen PERP
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q96FX8
Gene Alias dJ496H19.1, KCP1KCP-1, Keratinocyte-associated protein 1, KRTCAP11110017A08Rik, p53 apoptosis effector related to PMP22, p53 apoptosis effector related to PMP-22, P53-induced protein PIGPC1, PERP, TP53 apoptosis effector, PIGPC1RP3-496H19.1, THWkeratinocytes associated protein 1, Transmembrane protein THW
Gene Symbols PERP
Host Species Rabbit
Immunogen Synthetic peptides corresponding to PERP(PERP, TP53 apoptosis effector) The peptide sequence was selected form the middle region of PERP. Peptide sequence FLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFG.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 64065
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.