Learn More
Description
Specifications
Specifications
| Antigen | PERQ2 |
| Applications | Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | DKFZp686J17223, FLJ23368, GRB10 interacting GYF protein 2, GRB10-interacting GYF protein 2, GYF domain containing 2, GYF2, KIAA0642DKFZp686I15154, PARK11, Parkinson disease (autosomal recessive, early onset) 11, PERQ amino acid rich, with GYF domain 2, PERQ amino acid rich, with GYF domain 3, PERQ amino acid-rich with GYF domain-containing protein 2, PERQ2, PERQ3, TNRC15, trinucleotide repeat containing 15, Trinucleotide repeat-containing gene 15 protein |
| Gene Symbols | GIGYF2 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QHQQPNRARNNTHSNLHTSIGNSVWGSINTGPPNQWASDLVSSIWSNADTKNSNMGFWDDAVKEVGPRNSTNKNKNNASLSKSVGVSNRQNK |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
