Pet1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255967

Catalog No. NBP255967

Description

Pet1 Polyclonal specifically detects Pet1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: Pet1
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: FEV (ETS oncogene family), FEV (fifth Ewing variant), Fifth Ewing variant protein, HSRNAFEV, PC12 ETS domain-containing transcription factor 1, PC12 ETS factor 1, Pet-1, PET1, protein FEV
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54738
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FEV
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MRQSGASQPLLINMYLPDPVGDGLFKDGKNPSWGPLSPAVQKGSGQ
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only