PEX5 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP154597	100 μL

Catalog No. NBP154597 Supplier Novus Biologicals Supplier No. NBP154597

Description

Rabbit Polyclonal Antibody

PEX5 Polyclonal specifically detects PEX5 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot.

Specifications

• Antigen: PEX5
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: P50542-3
• Gene Alias: FLJ50634, FLJ50721, Peroxin-5, peroxisomal biogenesis factor 5, Peroxisomal C-terminal targeting signal import receptor, peroxisomal targeting signal 1 receptor, peroxisomal targeting signal import receptor, peroxisomal targeting signal receptor 1, Peroxisome receptor 1peroxin-5, PTS1 receptor, PTS1-BP, PTS1RFLJ51948, PXR1peroxisomal targeting signal 1 (SKL type) receptor
• Gene Symbols: PEX5
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to PEX5(peroxisomal biogenesis factor 5) The peptide sequence was selected from the middle region of PEX5. Peptide sequence LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL.
• Molecular Weight of Antigen: 70 kDa
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5830
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only