Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PEX7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15757820UL
Description
PEX7 Polyclonal specifically detects PEX7 in Human samples. It is validated for Western Blot.Specifications
PEX7 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
O00628 | |
PEX7 | |
Synthetic peptides corresponding to PEX7(peroxisomal biogenesis factor 7) The peptide sequence was selected from the N terminal of PEX7. Peptide sequence MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
peroxin-7, peroxisomal biogenesis factor 7, peroxisomal targeting signal 2 receptor, peroxisome targeting signal 2 receptor, PTS2 receptor, PTS2Rperoxisomal PTS2 receptor, RCDP1, RD | |
Rabbit | |
Affinity Purified | |
RUO | |
5191 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction