Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PEX7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | PEX7 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15757820
|
Novus Biologicals
NBP15757820UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP157578
|
Novus Biologicals
NBP157578 |
100 μL |
Each for $487.50
|
|
|||||
Description
PEX7 Polyclonal specifically detects PEX7 in Human samples. It is validated for Western Blot.Specifications
| PEX7 | |
| Polyclonal | |
| Rabbit | |
| O00628 | |
| 5191 | |
| Synthetic peptides corresponding to PEX7(peroxisomal biogenesis factor 7) The peptide sequence was selected from the N terminal of PEX7. Peptide sequence MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| peroxin-7, peroxisomal biogenesis factor 7, peroxisomal targeting signal 2 receptor, peroxisome targeting signal 2 receptor, PTS2 receptor, PTS2Rperoxisomal PTS2 receptor, RCDP1, RD | |
| PEX7 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title