Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PFKFB2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17963520UL
Description
PFKFB2 Polyclonal specifically detects PFKFB2 in Mouse samples. It is validated for Western Blot.Specifications
| PFKFB2 | |
| Polyclonal | |
| Western Blot 1:1000 | |
| NP_032851 | |
| PFKFB2 | |
| Synthetic peptide directed towards the C terminal of human Pfkfb2The immunogen for this antibody is Pfkfb2. Peptide Sequence: EMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQ | |
| Affinity Purified | |
| RUO | |
| 5208 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 6PF-2-K/Fru-2,6-P2ase 2, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2, 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2, DKFZp781D2217, fructose-2,6-bisphosphatase, cardiac isozyme, MGC138308,6PF-2-K/Fru-2,6-P2ase heart-type isozyme, MGC138310, PFK/FBPase 2, PFK-2/FBPase-2, PFKFB, cardiac | |
| Rabbit | |
| 57 kDa | |
| 20 μL | |
| Primary | |
| Mouse | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction