Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PFKFB2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$208.00 - $487.50
Specifications
| Antigen | PFKFB2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17963520
|
Novus Biologicals
NBP17963520UL |
20 μL |
Each for $208.00
|
|
|||||
|
NBP179635
|
Novus Biologicals
NBP179635 |
100 μL |
Each for $487.50
|
|
|||||
Description
PFKFB2 Polyclonal specifically detects PFKFB2 in Mouse samples. It is validated for Western Blot.Specifications
| PFKFB2 | |
| Polyclonal | |
| Rabbit | |
| NP_032851 | |
| 5208 | |
| Synthetic peptide directed towards the C terminal of human Pfkfb2The immunogen for this antibody is Pfkfb2. Peptide Sequence: EMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQ | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 6PF-2-K/Fru-2,6-P2ase 2, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2, 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2, DKFZp781D2217, fructose-2,6-bisphosphatase, cardiac isozyme, MGC138308,6PF-2-K/Fru-2,6-P2ase heart-type isozyme, MGC138310, PFK/FBPase 2, PFK-2/FBPase-2, PFKFB, cardiac | |
| PFKFB2 | |
| IgG | |
| 57 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title