Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PFKFB2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$208.00 - $487.50

Specifications

Antigen	PFKFB2
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP17963520 missing translation for 'viewDocuments' missing translation for 'viewProductCertificates' missing translation for 'viewAlternatives' missing translation for 'toSaveUpto'	Novus Biologicals NBP17963520UL	20 μL	Each for $208.00	Only null left	Sign In or Register to check your price. Add to cart

NBP179635 missing translation for 'viewDocuments' missing translation for 'viewProductCertificates' missing translation for 'viewAlternatives' missing translation for 'toSaveUpto'	Novus Biologicals NBP179635	100 μL	Each for $487.50	Only null left	Sign In or Register to check your price. Add to cart

Description

PFKFB2 Polyclonal specifically detects PFKFB2 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen	PFKFB2
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_032851
Gene ID (Entrez)	5208
Immunogen	Synthetic peptide directed towards the C terminal of human Pfkfb2The immunogen for this antibody is Pfkfb2. Peptide Sequence: EMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQ
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	6PF-2-K/Fru-2,6-P2ase 2, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2, 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2, DKFZp781D2217, fructose-2,6-bisphosphatase, cardiac isozyme, MGC138308,6PF-2-K/Fru-2,6-P2ase heart-type isozyme, MGC138310, PFK/FBPase 2, PFK-2/FBPase-2, PFKFB, cardiac
Gene Symbols	PFKFB2
Isotype	IgG
Molecular Weight of Antigen	57 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

PFKFB2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents