PGAP3 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP169334	100 μL

Catalog No. NBP169334 Supplier Novus Biologicals Supplier No. NBP169334

Description

Rabbit Polyclonal Antibody

PGAP3 Polyclonal specifically detects PGAP3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PGAP3
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q96FM1
• Gene Alias: AGLA546, CAB2COS16 homolog, Gene coamplified with ERBB2 protein, MGC9753hCOS16, PER1, per1-like domain containing 1, PERLD1PER1-like domain-containing protein 1, post-GPI attachment to proteins 3, post-GPI attachment to proteins factor 3, PP1498
• Gene Symbols: PGAP3
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to PERLD1(per1-like domain containing 1) The peptide sequence was selected from the N terminal of PERLD1. Peptide sequence AGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFRS.
• Molecular Weight of Antigen: 36 kDa
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 93210
• Test Specificity: Rat: 86%; Zebrafish: 85%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only