PGK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP254721

Catalog No. NBP254721

Description

PGK1 Polyclonal specifically detects PGK1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PGK1
• Classification: Polyclonal
• Dilution: Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: Cell migration-inducing gene 10 protein, EC 2.7.2.3, MGC142128, MGC8947, MIG10, PGKAMGC117307, phosphoglycerate kinase 1, Primer recognition protein 2, PRP 2
• Host Species: Rabbit
• Purification Method: Immunogen affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: PGK1
• Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:IEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
• Quantity: 100 μL
• Research Discipline: Prostate Cancer
• Gene ID (Entrez): 5230
• Target Species: Human
• Isotype: IgG