Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PGK1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | PGK1 |
---|---|
Dilution | Immunohistochemistry-Paraffin 1:20 - 1:50 |
Applications | Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
PGK1 Polyclonal specifically detects PGK1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PGK1 | |
Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
Cell migration-inducing gene 10 protein, EC 2.7.2.3, MGC142128, MGC8947, MIG10, PGKAMGC117307, phosphoglycerate kinase 1, Primer recognition protein 2, PRP 2 | |
PGK1 | |
IgG | |
Immunogen affinity purified |
Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Polyclonal | |
Rabbit | |
Prostate Cancer | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
5230 | |
This antibody was developed against a Recombinant Protein corresponding to amino acids:IEAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title