PGK2 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP154390	100 μL

Catalog No. NBP154390 Supplier Novus Biologicals Supplier No. NBP154390

Description

Rabbit Polyclonal Antibody

PGK2 Polyclonal antibody specifically detects PGK2 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: PGK2
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: P07205
• Gene Alias: dJ417L20.2, EC 2.7.2.3, PGK-2, PGKB, PGKPS, phosphoglycerate kinase 2, phosphoglycerate kinase autosomal pseudogene, Phosphoglycerate kinase, testis specific
• Gene Symbols: PGK2
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to PGK2(phosphoglycerate kinase 2) The peptide sequence was selected from the C terminal of PGK2. Peptide sequence ITVIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKILPGVEALSNM.
• Molecular Weight of Antigen: 46 kDa
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 5232
• Test Specificity: Zebrafish: 86%; Sheep: 85%; Bovine: 85%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only