Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PGM1 Antibody (CL3299), Novus Biologicals™

Mouse Monoclonal Antibody
Supplier: Novus Biologicals NBP261618
Description
PGM1 Monoclonal specifically detects PGM1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
PGM1 | |
Monoclonal | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
PGM1 | |
This antibody was developed against a recombinant protein corresponding to amino acids: SILATRKQSVEDILKDHWQKHGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSD | |
100 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG1 |
Western Blot, Immunohistochemistry | |
CL3299 | |
Western Blot 1 ug/ml, Immunohistochemistry 1:2500 - 1:5000 | |
EC 5.4.2, EC 5.4.2.2, Glucose phosphomutase 1, GSD14, PGM 1, phosphoglucomutase 1, phosphoglucomutase-1 | |
Mouse | |
Protein A purified | |
Lipid and Metabolism | |
5236 | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction