Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PGM1 Antibody (CL3299), Novus Biologicals™

Mouse Monoclonal Antibody

$382.00 - $610.00

Specifications

Antigen	PGM1
Clone	CL3299
Applications	Western Blot, Immunohistochemistry
Classification	Monoclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP261618 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP261618	100 μL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB393098 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP26161825UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

PGM1 Monoclonal specifically detects PGM1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	PGM1
Applications	Western Blot, Immunohistochemistry
Conjugate	Unconjugated
Host Species	Mouse
Target Species	Human
Gene ID (Entrez)	5236
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: SILATRKQSVEDILKDHWQKHGRNFFTRYDYEEVEAEGANKMMKDLEALMFDRSFVGKQFSANDKVYTVEKADNFEYSD
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Clone	CL3299
Classification	Monoclonal
Form	Purified
Research Discipline	Lipid and Metabolism
Gene Alias	EC 5.4.2, EC 5.4.2.2, Glucose phosphomutase 1, GSD14, PGM 1, phosphoglucomutase 1, phosphoglucomutase-1
Gene Symbols	PGM1
Isotype	IgG1
Purification Method	Protein A purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

PGM1 Antibody (CL3299), Novus Biologicals™

Specifications

Description

Specifications

Documents