Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PGRMC1 Antibody, Novus Biologicals™

PGRMC1 Antibody, Novus Biologicals™
SDP

Catalog No. NB433106 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB433106 25 μL
NBP183220 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB433106 Supplier Novus Biologicals Supplier No. NBP18322025UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 13 publications

PGRMC1 Polyclonal specifically detects PGRMC1 in Human, Mouse, Rat samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen PGRMC1
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/mL, Simple Western 1:20, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500-1:1000, KnockDown Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias HPR6.6PGRMC, membrane-associated progesterone receptor component 1, MPR, progesterone binding protein, progesterone receptor membrane component 1
Gene Symbols PGRMC1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DQPAASGDSDDDEPPPLPRLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASR
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer
Primary or Secondary Primary
Gene ID (Entrez) 10857
Test Specificity Specificity of human PGRMC1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Rat
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.