Learn More
Description
Specifications
Specifications
| Antigen | PHAX |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | FLJ13193, phosphorylated adapter RNA export protein, phosphorylated adaptor for RNA export, RNA U small nuclear RNA export adapter protein, RNA U, small nuclear RNA export adapter (phosphorylation regulated), RNA U, small nuclear RNA export adaptor (phosphorylation regulated), RNUXA |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PHAX (NP_115553.2). Peptide sequence IMNGSRRRTPGGVFLNLLKNTPSISEEQIKDIFYIENQKEYENKKAARKR |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
