Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PHF20L1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | PHF20L1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179401
|
Novus Biologicals
NBP179401 |
100 μL |
Each for $480.74
|
|
|||||
|
NBP1794020
|
Novus Biologicals
NBP17940120UL |
20 μL | N/A | N/A | N/A | ||||
Description
PHF20L1 Polyclonal specifically detects PHF20L1 in Human samples. It is validated for Western Blot.Specifications
| PHF20L1 | |
| Polyclonal | |
| Rabbit | |
| NP_115581 | |
| 51105 | |
| Synthetic peptide directed towards the N terminal of human PHF20L1The immunogen for this antibody is PHF20L1. Peptide sequence AAKNKTGSKPRTSANSNKDKDKDERKWFKVPSKKEETSTCIATPDVEKKE. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CGI-72, FLJ13649, FLJ21615, MGC64923, PHD finger protein 20-like 1, PHD finger protein 20-like protein 1, tudor domain-containing protein PHF20L1 | |
| PHF20L1 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title