Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PHF20L1 Antibody, Novus Biologicals™

PHF20L1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1794020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1794020 20 μL
NBP179401 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1794020 Supplier Novus Biologicals Supplier No. NBP17940120UL

Description

Rabbit Polyclonal Antibody

PHF20L1 Polyclonal specifically detects PHF20L1 in Human samples. It is validated for Western Blot.

Specifications

Antigen PHF20L1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_115581
Gene Alias CGI-72, FLJ13649, FLJ21615, MGC64923, PHD finger protein 20-like 1, PHD finger protein 20-like protein 1, tudor domain-containing protein PHF20L1
Gene Symbols PHF20L1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human PHF20L1The immunogen for this antibody is PHF20L1. Peptide sequence AAKNKTGSKPRTSANSNKDKDKDERKWFKVPSKKEETSTCIATPDVEKKE.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51105
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.