Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PHLDA1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP153065
Description
PHLDA1 Polyclonal specifically detects PHLDA1 in Human samples. It is validated for Western Blot.Specifications
PHLDA1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
PHLDA1 | |
Synthetic peptides corresponding to PHLDA1(pleckstrin homology-like domain, family A, member 1) The peptide sequence was selected from the middle region of PHLDA1. Peptide sequence PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP. | |
Affinity purified | |
RUO | |
22822 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Apoptosis-associated nuclear protein, DT1P1B11, MGC131738, PHRIPT-cell death-associated gene 51 protein, pleckstrin homology-like domain family A member 1, pleckstrin homology-like domain, family A, member 1, PQ-rich protein, Proline- and glutamine-rich protein, Proline- and histidine-rich protein, proline-histidine rich protein, TDAG51PQR protein | |
Rabbit | |
45 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction