Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PHLDA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | PHLDA1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PHLDA1 Polyclonal specifically detects PHLDA1 in Human samples. It is validated for Western Blot.Specifications
| PHLDA1 | |
| Polyclonal | |
| Rabbit | |
| Apoptosis-associated nuclear protein, DT1P1B11, MGC131738, PHRIPT-cell death-associated gene 51 protein, pleckstrin homology-like domain family A member 1, pleckstrin homology-like domain, family A, member 1, PQ-rich protein, Proline- and glutamine-rich protein, Proline- and histidine-rich protein, proline-histidine rich protein, TDAG51PQR protein | |
| PHLDA1 | |
| IgG | |
| 45 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| 22822 | |
| Synthetic peptides corresponding to PHLDA1(pleckstrin homology-like domain, family A, member 1) The peptide sequence was selected from the middle region of PHLDA1. Peptide sequence PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMAEGKEIDFRCP. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title