Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PHLDA3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15677220UL
Description
PHLDA3 Polyclonal specifically detects PHLDA3 in Human samples. It is validated for Western Blot.Specifications
PHLDA3 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9Y5J5 | |
PHLDA3 | |
Synthetic peptides corresponding to PHLDA3(pleckstrin homology-like domain, family A, member 3) The peptide sequence was selected from the N terminal of PHLDA3. Peptide sequence LQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRC. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
family A, member 2, pleckstrin homology-like domain, family A, member 3, TIH1TDAG51/Ipl homolog 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
23612 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction