Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PHLDA3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PHLDA3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP156772
![]() |
Novus Biologicals
NBP156772 |
100 μL |
Each for $487.50
|
|
|||||
NBP15677220
![]() |
Novus Biologicals
NBP15677220UL |
20 μL | N/A | N/A | N/A | ||||
Description
PHLDA3 Polyclonal specifically detects PHLDA3 in Human samples. It is validated for Western Blot.Specifications
PHLDA3 | |
Polyclonal | |
Rabbit | |
Q9Y5J5 | |
23612 | |
Synthetic peptides corresponding to PHLDA3(pleckstrin homology-like domain, family A, member 3) The peptide sequence was selected from the N terminal of PHLDA3. Peptide sequence LQLFEAKGTGGRPKELSFARIKAVECVESTGRHIYFTLVTEGGGEIDFRC. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
family A, member 2, pleckstrin homology-like domain, family A, member 3, TIH1TDAG51/Ipl homolog 1 | |
PHLDA3 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title