Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP233887

PHLPP Antibody, Novus Biologicals™
SDP

Catalog No. NBP233887 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP233887 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP233887 Supplier Novus Biologicals Supplier No. NBP233887

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Description

Rabbit Polyclonal Antibody

PHLPP Polyclonal specifically detects PHLPP in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen PHLPP
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. O60346
Gene Alias EC 3.1.3.16, hSCOP, KIAA0606, MGC161555, PH domain and leucine rich repeat protein phosphatase, PH domain and leucine rich repeat protein phosphatase 1, PH domain leucine-rich repeat-containing protein phosphatase 1, PHLPP, pleckstrin homology domain containing, family E (with leucine rich repeats)member 1, Pleckstrin homology domain-containing family E member 1, PLEKHE1, SCN circadian oscillatory protein, SCOPPH domain-containing family E member 1, Suprachiasmatic nucleus circadian oscillatory protein
Gene Symbols PHLPP1
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: SLDRKTLLLKHRQTLQLQPSDRDWVRHQLQRGCVHVFDRHMASTYLRPVLCTLDTTAGEVAARLLQLGHKGGGVVKVLGQ
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Cancer, Protein Phosphatase, Tumor Suppressors
Primary or Secondary Primary
Gene ID (Entrez) 23239
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.