PHLPP Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233887

Catalog No. NBP233887

Description

PHLPP Polyclonal specifically detects PHLPP in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: PHLPP
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Accession No.: O60346
• Gene Symbols: PHLPP1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SLDRKTLLLKHRQTLQLQPSDRDWVRHQLQRGCVHVFDRHMASTYLRPVLCTLDTTAGEVAARLLQLGHKGGGVVKVLGQ
• Quantity: 0.1 mL
• Research Discipline: Cancer, Protein Phosphatase, Tumor Suppressors
• Gene ID (Entrez): 23239
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 3.1.3.16, hSCOP, KIAA0606, MGC161555, PH domain and leucine rich repeat protein phosphatase, PH domain and leucine rich repeat protein phosphatase 1, PH domain leucine-rich repeat-containing protein phosphatase 1, PHLPP, pleckstrin homology domain containing, family E (with leucine rich repeats)member 1, Pleckstrin homology domain-containing family E member 1, PLEKHE1, SCN circadian oscillatory protein, SCOPPH domain-containing family E member 1, Suprachiasmatic nucleus circadian oscillatory protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only