Phosphodiesterase 4A/PDE4A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23338825UL

Catalog No. NB397441

Description

Phosphodiesterase 4A/PDE4A Polyclonal specifically detects Phosphodiesterase 4A/PDE4A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Phosphodiesterase 4A/PDE4A
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: P27815
• Gene Symbols: PDE4A
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EAVYLTQQAQSTGSAPVAPDEFSSREEFVVAVSHSSPSALALQSPLLPAWRTLSVSEHA
• Quantity: 25 μL
• Research Discipline: Apoptosis, Signal Transduction, Stem Cell Markers
• Gene ID (Entrez): 5141
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: cAMP-specific 3'-5'-cyclic phosphodiesterase 4A, DPDE2cAMP-specific phosphodiesterase, EC 3.1.4, EC 3.1.4.17, PDE4, PDE46, phosphodiesterase 4A, cAMP-specific, phosphodiesterase 4A, cAMP-specific (dunce, phosphodiesterase 4A, cAMP-specific (dunce (Drosophila)-homologphosphodiesterase E2), phosphodiesterase E2 dunce homolog, Drosophila, phosphodiesterase isozyme 4
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only