Phospholipase A2 XII Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP187265

Catalog No. NBP187265

Description

Phospholipase A2 XII Polyclonal specifically detects Phospholipase A2 XII in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Phospholipase A2 XII
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: EC 3.1.1.4, group XII secreted phospholipase A2, group XIIA secreted phospholipase A2, group XIIA secretory phospholipase A2, GXII, GXII sPLA2, Phosphatidylcholine 2-acylhydrolase 12A, phospholipase A2, group XII, phospholipase A2, group XIIA, PLA2G12, ROSSY, sPLA2-XII
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: PLA2G12A
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:IGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHY
• Quantity: 0.1 mL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 81579
• Target Species: Human
• Isotype: IgG

For Research Use Only