Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. Phospholipase A2 XII Antibody, Novus Biologicals™

Phospholipase A2 XII Antibody, Novus Biologicals™
SDP

Catalog No. NBP187265 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP187265 0.1 mL
NB431491 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP187265 Supplier Novus Biologicals Supplier No. NBP187265
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Phospholipase A2 XII Polyclonal specifically detects Phospholipase A2 XII in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen Phospholipase A2 XII
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias EC 3.1.1.4, group XII secreted phospholipase A2, group XIIA secreted phospholipase A2, group XIIA secretory phospholipase A2, GXII, GXII sPLA2, Phosphatidylcholine 2-acylhydrolase 12A, phospholipase A2, group XII, phospholipase A2, group XIIA, PLA2G12, ROSSY, sPLA2-XII
Gene Symbols PLA2G12A
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IGIPSLTKCCNQHDRCYETCGKSKNDCDEEFQYCLSKICRDVQKTLGLTQHVQACETTVELLFDSVIHLGCKPYLDSQRAACRCHY
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 81579
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.