Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Phospholipid Scramblase 1/PLSCR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP15781620UL

View more versions of this product

Catalog No. NBP15781620

$206.00 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

Phospholipid Scramblase 1/PLSCR1 Polyclonal specifically detects Phospholipid Scramblase 1/PLSCR1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	Phospholipid Scramblase 1/PLSCR1
Classification	Polyclonal
Dilution	Western Blot 1:100-1:2000, Immunohistochemistry
Gene Accession No.	O15162
Gene Symbols	PLSCR1
Immunogen	Synthetic peptides corresponding to PLSCR1(phospholipid scramblase 1) Antibody(against the N terminal of PLSCR1. Peptide sequence MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP.
Quantity	20 μL
Primary or Secondary	Primary
Target Species	Human
Isotype	IgG

Applications	Western Blot, Immunohistochemistry
Conjugate	Unconjugated
Formulation	PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias	Erythrocyte phospholipid scramblase, MmTRA1b, MMTRA1BCa(2+)-dependent phospholipid scramblase 1, phospholipid scramblase 1, PL scramblase 1
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Gene ID (Entrez)	5359
Content And Storage	Store at -20C. Avoid freeze-thaw cycles.

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

Spot an opportunity for improvement?Share a Content Correction

Phospholipid Scramblase 1/PLSCR1 Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions