Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PHOX2B Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	PHOX2B
Dilution	Western Blot 1.0 ug/ml
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB125855 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP310477100UL	100 μg	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

PHOX2B Polyclonal specifically detects PHOX2B in Rat samples. It is validated for Western Blot.

Specifications

Antigen	PHOX2B
Applications	Western Blot
Conjugate	Unconjugated
Host Species	Rabbit
Research Discipline	Neuroscience
Formulation	PBS buffer, 2% sucrose
Gene ID (Entrez)	8929
Primary or Secondary	Primary
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Dilution	Western Blot 1.0 ug/ml
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Target Species	Rat
Gene Alias	NBPHOX, NBPhoxPhox2b, Neuroblastoma Phox, paired mesoderm homeobox 2b, paired mesoderm homeobox protein 2B, paired-like homeobox 2bNBLST2, PHOX2B homeodomain protein, PMX2Bneuroblastoma paired-type homeobox protein
Immunogen	The immunogen is a synthetic peptide directed towards the N-terminal region of Rat PHOX2B (XP_001077800). Peptide sequence MYKMEYSYLNSSAYESCMAGMDTSSLASAYADFSSCSQASGFQYNPIRTT
Purification Method	Affinity purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

PHOX2B Rabbit anti-Rat, Polyclonal, Novus Biologicals™

Specifications

Description

Specifications

Documents