Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PI 3-Kinase p110 beta/PIK3CB Antibody, Novus Biologicals™

PI 3-Kinase p110 beta/PIK3CB Antibody, Novus Biologicals™
SDP

Catalog No. NBP256397 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP256397 100 μL
NB403709 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP256397 Supplier Novus Biologicals Supplier No. NBP256397
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PI 3-Kinase p110 beta/PIK3CB Polyclonal specifically detects PI 3-Kinase p110 beta/PIK3CB in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen PI 3-Kinase p110 beta/PIK3CB
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias P110BETA, PI3K, PI3KBETA, PIK3C1, PIK3CB phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta
Gene Symbols PIK3CB
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LSLVGLSWMDWLKQTYPPEHEPSIPENLEDKLYGGKLIVAVHFENCQDVFSFQVSPNMNPIKVNELAIQKRLTIHGK
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Apoptosis, Cancer, Cell Cycle and Replication, mTOR Pathway
Primary or Secondary Primary
Gene ID (Entrez) 5291
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.