Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

PI 3-Kinase p110 delta Antibody, Novus Biologicals™
SDP

Catalog No. NB396781 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396781 25 μL
NBP238535 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB396781 Supplier Novus Biologicals Supplier No. NBP23853525UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

PI 3-Kinase p110 delta Polyclonal specifically detects PI 3-Kinase p110 delta in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen PI 3-Kinase p110 delta
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 μg/mL, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias EC 2.7.1, EC 2.7.1.153, p110D, P110DELTA, Phosphatidylinositol-4,5-bisphosphate 3-kinase 110 kDa catalytic subunit delta, phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit delta isoform, phosphoinositide-3-kinase C, phosphoinositide-3-kinase, catalytic, delta polypeptide, PI3K, PI3K-delta, PI3-kinase p110 subunit delta, PI3-kinase subunit delta, PtdIns-3-kinase subunit delta, PtdIns-3-kinase subunit p110-delta
Gene Symbols PIK3CD
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: AECSRLLQILELGRHSECVHVTEEEQLQLREILERRGSGELYEHEKDLVWKLRHEVQEHFPEALARLLLVTKWN
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Autophagy, mTOR Pathway, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5293
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.