Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PI 3-Kinase p85 alpha Antibody, Novus Biologicals™

PI 3-Kinase p85 alpha Antibody, Novus Biologicals™
SDP

Catalog No. NB430562 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB430562 25 μL
NBP189731 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB430562 Supplier Novus Biologicals Supplier No. NBP18973125UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PI 3-Kinase p85 alpha Polyclonal specifically detects PI 3-Kinase p85 alpha in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen PI 3-Kinase p85 alpha
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.2mg/mL
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias GRB1PI3-kinase subunit p85-alpha, p85, p85-ALPHA, Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha, phosphatidylinositol 3-kinase regulatory subunit alpha, phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha), phosphatidylinositol 3-kinase, regulatory, 1, phosphatidylinositol 3-kinase-associated p-85 alpha, phosphoinositide-3-kinase, regulatory subunit 1 (alpha), PI3K regulatory subunit alpha, PI3-kinase regulatory subunit alpha, PtdIns-3-kinase regulatory subunit alpha, PtdIns-3-kinase regulatory subunit p85-alpha
Gene Symbols PIK3R1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSL
Molecular Weight of Antigen 84 kDa
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Diabetes Research, Immune Dysfunction, Lipid and Metabolism, mTOR Pathway, Protein Kinase, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5295
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.