Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PI 3-Kinase p85 alpha Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$274.85 - $530.46
Specifications
| Antigen | PI 3-Kinase p85 alpha |
|---|---|
| Concentration | 0.2mg/mL |
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
Description
PI 3-Kinase p85 alpha Polyclonal specifically detects PI 3-Kinase p85 alpha in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| PI 3-Kinase p85 alpha | |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:200-1:500 | |
| Polyclonal | |
| Rabbit | |
| Cancer, Diabetes Research, Immune Dysfunction, Lipid and Metabolism, mTOR Pathway, Protein Kinase, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 5295 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:LADAFKRYLLDLPNPVIPAAVYSEMISLAPEVQSSEEYIQLLKKLIRSPSIPHQYWLTLQYLLKHFFKLSQTSSKNLLNARVLSEIFSPMLFRFSAASSDNTENLIKVIEILISTEWNERQPAPALPPKPPKPTTVANNGMNNNMSL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| 84 kDa |
| 0.2mg/mL | |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| GRB1PI3-kinase subunit p85-alpha, p85, p85-ALPHA, Phosphatidylinositol 3-kinase 85 kDa regulatory subunit alpha, phosphatidylinositol 3-kinase regulatory subunit alpha, phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 1 (p85 alpha), phosphatidylinositol 3-kinase, regulatory, 1, phosphatidylinositol 3-kinase-associated p-85 alpha, phosphoinositide-3-kinase, regulatory subunit 1 (alpha), PI3K regulatory subunit alpha, PI3-kinase regulatory subunit alpha, PtdIns-3-kinase regulatory subunit alpha, PtdIns-3-kinase regulatory subunit p85-alpha | |
| PIK3R1 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title