Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PI 3-Kinase p85 beta Rabbit anti-Human, Mouse, Rat, Clone: 6E2F5, Novus Biologicals™

Rabbit Monoclonal Antibody
$205.50 - $458.50
Specifications
Antigen | PI 3-Kinase p85 beta |
---|---|
Clone | 6E2F5 |
Dilution | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Monoclonal |
Description
PI 3-Kinase p85 beta Monoclonal antibody specifically detects PI 3-Kinase p85 beta in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
PI 3-Kinase p85 beta | |
Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin | |
Monoclonal | |
Purified | |
RUO | |
Human, Mouse, Rat | |
P85B, phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta, phosphatidylinositol 3-kinase regulatory subunit beta, phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 2 (p85 beta), phosphoinositide-3-kinase, regulatory subunit 2 (beta), phosphoinositide-3-kinase, regulatory subunit 2 (p85 beta), phosphoinositide-3-kinase, regulatory subunit, polypeptide 2 (p85 beta), PI3K regulatory subunit beta, PI3-kinase regulatory subunit beta, PI3-kinase subunit p85-beta, ptdIns-3-kinase regulatory subunit beta, ptdIns-3-kinase regulatory subunit p85-beta | |
A synthetic peptide corresponding to a sequence within amino acids 100-200 of human PI 3-Kinase p85 beta (O00459). PRDGAPEPGLTLPDLPEQFSPPDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLALPAPLVTPEASAEARRALRE | |
Primary | |
Store at -20°C. Avoid freeze-thaw cycles. |
6E2F5 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Autophagy, Signal Transduction | |
PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
5296 | |
IgG | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title