Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PI 3-Kinase p85 beta Rabbit anti-Human, Mouse, Rat, Clone: 6E2F5, Novus Biologicals™

PI 3-Kinase p85 beta Rabbit anti-Human, Mouse, Rat, Clone: 6E2F5, Novus Biologicals™
SDP

Catalog No. NB168078 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB168078 20 μg
NB168077 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB168078 Supplier Novus Biologicals Supplier No. NBP31649320UL
Only null left
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

PI 3-Kinase p85 beta Monoclonal antibody specifically detects PI 3-Kinase p85 beta in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen PI 3-Kinase p85 beta
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone 6E2F5
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias P85B, phosphatidylinositol 3-kinase 85 kDa regulatory subunit beta, phosphatidylinositol 3-kinase regulatory subunit beta, phosphatidylinositol 3-kinase, regulatory subunit, polypeptide 2 (p85 beta), phosphoinositide-3-kinase, regulatory subunit 2 (beta), phosphoinositide-3-kinase, regulatory subunit 2 (p85 beta), phosphoinositide-3-kinase, regulatory subunit, polypeptide 2 (p85 beta), PI3K regulatory subunit beta, PI3-kinase regulatory subunit beta, PI3-kinase subunit p85-beta, ptdIns-3-kinase regulatory subunit beta, ptdIns-3-kinase regulatory subunit p85-beta
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 100-200 of human PI 3-Kinase p85 beta (O00459). PRDGAPEPGLTLPDLPEQFSPPDVAPPLLVKLVEAIERTGLDSESHYRPELPAPRTDWSLSDVDQWDTAALADGIKSFLLALPAPLVTPEASAEARRALRE
Purification Method Affinity purified
Quantity 20 μg
Regulatory Status RUO
Research Discipline Autophagy, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 5296
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.