Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PI 4 Kinase type 2 beta Antibody, Novus Biologicals™

PI 4 Kinase type 2 beta Antibody, Novus Biologicals™
SDP

Catalog No. NBP174233 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP174233 100 μL
NBP17423320 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP174233 Supplier Novus Biologicals Supplier No. NBP174233
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

PI 4 Kinase type 2 beta Polyclonal specifically detects PI 4 Kinase type 2 beta in Mouse samples. It is validated for Western Blot.

Specifications

Antigen PI 4 Kinase type 2 beta
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8CBQ5
Gene Alias EC 2.7.1.67, FLJ11105, phosphatidylinositol 4-kinase type 2 beta, phosphatidylinositol 4-kinase type 2-beta, Phosphatidylinositol 4-kinase type II-beta, phosphatidylinositol 4-kinase type-II beta, PI4KIIB, PI4KII-BETA, PIK42B
Gene Symbols PI4K2B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to the N terminal of Pi4k2b. Immunizing peptide sequence EDPEFADIVLKAEQAIEIGVFPERISQGSSGSYFVKDSKRNIIGVFKPKS.
Molecular Weight of Antigen 52 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55300
Test Specificity Expected identity based on immunogen sequence: .
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.