PIGA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159701

Catalog No. NBP159701

Description

PIGA Polyclonal specifically detects PIGA in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PIGA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: class A GlcNAc-inositol phospholipid assembly protein, EC 2.4.1.198, GlcNAc-PI synthesis protein, GPI anchor biosynthesis, GPI3, phosphatidylinositol glycan anchor biosynthesis, class A, phosphatidylinositol glycan, class A (paroxysmal nocturnal hemoglobinuria), phosphatidylinositol N-acetylglucosaminyltransferase subunit A, Phosphatidylinositol-glycan biosynthesis class A protein, phosphatidylinositol-glycan biosynthesis, class A protein, PIG-A
• Host Species: Rabbit
• Molecular Weight of Antigen: 19 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: A.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: B3KUV7
• Gene Symbols: PIGA
• Immunogen: Synthetic peptides corresponding to PIGA(phosphatidylinositol glycan anchor biosynthesis, class A) The peptide sequence was selected from the middle region of PIGA. Peptide sequence SVKSLCEGLEKAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 5277
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.