Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PIGA Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | PIGA |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
PIGA Polyclonal specifically detects PIGA in Human samples. It is validated for Western Blot.Specifications
| PIGA | |
| Polyclonal | |
| Rabbit | |
| B3KUV7 | |
| 5277 | |
| Synthetic peptides corresponding to PIGA(phosphatidylinositol glycan anchor biosynthesis, class A) The peptide sequence was selected from the middle region of PIGA. Peptide sequence SVKSLCEGLEKAIFQLKSGTLPAPENIHNIVKTFYTWRNVAERTEKVYDR. | |
| Primary | |
| 19 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| class A GlcNAc-inositol phospholipid assembly protein, EC 2.4.1.198, GlcNAc-PI synthesis protein, GPI anchor biosynthesis, GPI3, phosphatidylinositol glycan anchor biosynthesis, class A, phosphatidylinositol glycan, class A (paroxysmal nocturnal hemoglobinuria), phosphatidylinositol N-acetylglucosaminyltransferase subunit A, Phosphatidylinositol-glycan biosynthesis class A protein, phosphatidylinositol-glycan biosynthesis, class A protein, PIG-A | |
| PIGA | |
| IgG | |
| This product is specific to Subunit or Isoform: A. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title