PIGQ Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159740

Catalog No. NBP159740

Description

PIGQ Polyclonal specifically detects PIGQ in Human samples. It is validated for Western Blot.

Specifications

• Antigen: PIGQ
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: c407A10.1, c407A10.1 (GPI1 (N-acetylglucosaminyl transferase component)), class Q, EC 2.4.1.198, hGPI1, MGC12693, N-acetylglucosaminyl transferase component Gpi1, N-acetylglucosamyl transferase component GPI1, phosphatidylinositol glycan anchor biosynthesis, class Q, phosphatidylinositol N-acetylglucosaminyltransferase subunit Q, Phosphatidylinositol-glycan biosynthesis class Q protein, PIG-Q
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9091
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: B2RAU6
• Gene Symbols: PIGQ
• Immunogen: Synthetic peptides corresponding to PIGQ(phosphatidylinositol glycan anchor biosynthesis, class Q) The peptide sequence was selected from the N terminal of PIGQ. Peptide sequence PTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQS.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: Q.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG