PIGS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP174155

Catalog No. NBP174155

Description

PIGS Polyclonal specifically detects PIGS in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: PIGS
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DKFZp686K20216, FLJ45226, GPI transamidase component PIG-S, GPI transamidase subunit, phosphatidylinositol glycan anchor biosynthesis, class S, phosphatidylinositol glycan, class S, Phosphatidylinositol-glycan biosynthesis class S protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 94005
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6PD26
• Gene Symbols: PIGS
• Immunogen: Synthetic peptides corresponding to thesis class S Antibody against the C terminal of Pigs. Immunizing peptide sequence AVAAVQKAAKALALGHLSSAFAASQEAVTSSERAFFDPSLLHLLYFPDDQ.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG