Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PIGW Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | PIGW |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
PIGW Polyclonal specifically detects PIGW in Rat samples. It is validated for Western Blot.Specifications
PIGW | |
Polyclonal | |
Rabbit | |
NP_919443 | |
284098 | |
Synthetic peptide directed towards the middle region of human PigwThe immunogen for this antibody is Pigw. Peptide sequence SIGYQEHSTEYGVHWNFFFTIIVVKLITSLLLIIFPLNKSWIVAISITVL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
class W, EC 2.3, FLJ37433, phosphatidylinositol glycan anchor biosynthesis, class W, PIG-W | |
PIGW | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title