PIGW Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP160017

Catalog No. NBP160017

Description

PIGW Polyclonal specifically detects PIGW in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: PIGW
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: class W, EC 2.3, FLJ37433, phosphatidylinositol glycan anchor biosynthesis, class W, PIG-W
• Host Species: Rabbit
• Molecular Weight of Antigen: 57 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 92%; Rat: 92%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q7Z7B1
• Gene Symbols: PIGW
• Immunogen: Synthetic peptides corresponding to PIGW(phosphatidylinositol glycan anchor biosynthesis, class W) The peptide sequence was selected from the middle region of PIGW. Peptide sequence: IALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLNANREGIISTLGYV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 284098
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.