Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PIGW Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16001720UL
Description
PIGW Polyclonal specifically detects PIGW in Human, Mouse samples. It is validated for Western Blot.Specifications
PIGW | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q7Z7B1 | |
PIGW | |
Synthetic peptides corresponding to PIGW(phosphatidylinositol glycan anchor biosynthesis, class W) The peptide sequence was selected from the middle region of PIGW. Peptide sequence IALGITVLYQLALDFTSLKRLILYGTDGSGTRVGLLNANREGIISTLGYV. | |
Affinity Purified | |
RUO | |
284098 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
class W, EC 2.3, FLJ37433, phosphatidylinositol glycan anchor biosynthesis, class W, PIG-W | |
Rabbit | |
57 kDa | |
20 μL | |
Primary | |
Human, Mouse | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction