Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
PIK3R5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP156922
Description
PIK3R5 Polyclonal specifically detects PIK3R5 in Human, Mouse samples. It is validated for Western Blot.Specifications
| PIK3R5 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| F730038I15Rik, FOAP-2, p101, P101-PI3K, Phosphatidylinositol-4,5-bisphosphate 3-kinase regulatory subunit, phosphoinositide-3-kinase, regulatory subunit 5, phosphoinositide-3-kinase, regulatory subunit, polypeptide p101, PI3-kinase p101 subunit, PI3-kinase regulatory subunit 5, PtdIns-3-kinase regulatory subunit, regulatory subunit 5, p101 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 23533 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q8WYR1 | |
| PIK3R5 | |
| Synthetic peptides corresponding to PIK3R5(phosphoinositide-3-kinase, regulatory subunit 5) The peptide sequence was selected from the N terminal of PIK3R5. Peptide sequence HRFLTWPVPYCSICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSS. | |
| 100 μL | |
| Primary | |
| This product is specific to Subunit or Isoform: 5. | |
| Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction