PIK3R5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15692220UL

Catalog No. NBP15692220

Description

PIK3R5 Polyclonal specifically detects PIK3R5 in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: PIK3R5
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q8WYR1
• Gene Symbols: PIK3R5
• Immunogen: Synthetic peptides corresponding to PIK3R5(phosphoinositide-3-kinase, regulatory subunit 5) The peptide sequence was selected from the N terminal of PIK3R5. Peptide sequence HRFLTWPVPYCSICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSS.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: 5.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: F730038I15Rik, FOAP-2, p101, P101-PI3K, Phosphatidylinositol-4,5-bisphosphate 3-kinase regulatory subunit, phosphoinositide-3-kinase, regulatory subunit 5, phosphoinositide-3-kinase, regulatory subunit, polypeptide p101, PI3-kinase p101 subunit, PI3-kinase regulatory subunit 5, PtdIns-3-kinase regulatory subunit, regulatory subunit 5, p101
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 23533
• Target Species: Human
• Isotype: IgG